PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_12356g0020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 94aa    MW: 10148.4 Da    PI: 8.2942
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_12356g0020genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.23.4e-322784260
    ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                   ++vrY eC+kNhAas+Gg+avDGCgEfm+s g+egtaaa++CaAC+CHR+FHR++ve+e
  MA_12356g0020 27 KSVRYGECRKNHAASIGGYAVDGCGEFMAS-GDEGTAAAMRCAACNCHRSFHRKKVEKE 84
                   579**************************9.999*********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257747.0E-222790IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047706.6E-302981IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.2E-273080IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.0833180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 94 aa     Download sequence    Send to blast
MGPSEIVQQI EAGSAATARE GDIASRKSVR YGECRKNHAA SIGGYAVDGC GEFMASGDEG  60
TAAAMRCAAC NCHRSFHRKK VEKETLCECH RIRR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1082341e-137BT108234.1 Picea glauca clone GQ03118_L05 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931461.14e-33PREDICTED: mini zinc finger protein 1-like
SwissprotQ9LJW52e-29MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA9NK892e-46A9NK89_PICSI; Putative uncharacterized protein
STRINGPP1S3_539V6.12e-28(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.11e-30mini zinc finger 2